Web Analysis for Kayserievdenevenakliyatfirmalari - kayserievdenevenakliyatfirmalari.com
Kayseri evden eve nakliyat, sektörü; şehir içi ev taşıma, şehirler arası nakliye hizmetleri sağlayan eşya taşıma ve nakliyat firmalar için tıklayın.
kayserievdenevenakliyatfirmalari.com is 8 years 15 hours old. It is a domain having com extension. It has a global traffic rank of #8137110 in the world. This website is estimated worth of $ 240.00 and have a daily income of around $ 1.00. As no active threats were reported recently by users, kayserievdenevenakliyatfirmalari.com is SAFE to browse.
PageSpeed Score
Siteadvisor Rating
Traffic Report
Daily Unique Visitors: | 103 |
Daily Pageviews: | 206 |
Estimated Valuation
Income Per Day: | $ 1.00 |
Estimated Worth: | $ 240.00 |
Search Engine Indexes
Google Indexed Pages: | 272 |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | 86 |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | No Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 8,137,110 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 12 | H2 Headings: | 13 |
H3 Headings: | 6 | H4 Headings: | Not Applicable |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | 1 | Total Images: | 10 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
Websites Hosted on Same IP (i.e. 94.199.200.87)
Özcanlar Mermer Granit | Yapı Malzemeleri
Özcanlar Mermer Granit, güler yüzlü hizmet, güven ve kalitenin adresi
HTTP Header Analysis
Connection: close
X-Powered-By: PHP/7.3.12
Content-Type: text/html; charset=UTF-8
Link: <https://www.kayserievdenevenakliyatfirmalari.com/wp-json/>; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Encoding: gzip
Vary: Accept-Encoding
Date: Sun, 15 Dec 2019 18:50:35 GMT
Domain Information
Domain Nameserver Information
Host | IP Address | Country | |
---|---|---|---|
cpns1.turhost.com | 37.230.110.110 | Türkiye | |
cpns2.turhost.com | 37.230.111.111 | Türkiye |
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
kayserievdenevenakliyatfirmalari.com | A | 10798 |
IP: 94.199.200.87 |
kayserievdenevenakliyatfirmalari.com | NS | 86400 |
Target: cpns2.turdns.com |
kayserievdenevenakliyatfirmalari.com | NS | 86400 |
Target: cpns1.turdns.com |
kayserievdenevenakliyatfirmalari.com | SOA | 10800 |
MNAME: cpns1.turdns.com RNAME: csf.ofis.net Serial: 2019062307 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
kayserievdenevenakliyatfirmalari.com | MX | 14400 |
Target: kayserievdenevenakliyatfirmalari.com |
kayserievdenevenakliyatfirmalari.com | TXT | 14400 |
TXT: v=spf1 ip4:94.199.200.85 ip4:176.53.69.201 +a +mx ~all |
Similarly Ranked Websites
sageandheart.com - sageandheart Resources and Information.
sageandheart.com is your first and best source for all of the information you’re looking for. From general topics to more of what you would expect to find here, sageandheart.com has it all. We hope you find what you are searching for!
Full WHOIS Lookup
Registry Domain ID: 2025414223_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.publicdomainregistry.com
Registrar URL: www.publicdomainregistry.com
Updated Date: 2018-08-23T10:57:44Z
Creation Date: 2016-05-02T15:23:07Z
Registrar Registration Expiration Date: 2020-05-02T15:23:07Z
Registrar: PDR Ltd. d/b/a PublicDomainRegistry.com
Registrar IANA ID: 303
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Registry Registrant ID: Not Available From Registry
Registrant Name: GDPR Masked
Registrant Organization: GDPR Masked
Registrant Street: GDPR Masked GDPR Masked GDPR Masked
Registrant City: GDPR Masked
Registrant State/Province: melikgazi
Registrant Postal Code: GDPR Masked
Registrant Country: TR
Registrant Phone: +GDPR Masked.GDPR Masked
Registrant Phone Ext:
Registrant Fax: +GDPR Masked.GDPR Masked
Registrant Fax Ext:
Registrant Email: gdpr-masking@gdpr-masked.com
Registry Admin ID: Not Available From Registry
Admin Name: GDPR Masked
Admin Organization: GDPR Masked
Admin Street: GDPR Masked GDPR Masked GDPR Masked
Admin City: GDPR Masked
Admin State/Province:
Admin Postal Code: GDPR Masked
Admin Country: CY
Admin Phone: +GDPR Masked.GDPR Masked
Admin Phone Ext:
Admin Fax: +GDPR Masked.GDPR Masked
Admin Fax Ext:
Admin Email: gdpr-masking@gdpr-masked.com
Registry Tech ID: Not Available From Registry
Tech Name: GDPR Masked
Tech Organization: GDPR Masked
Tech Street: GDPR Masked GDPR Masked GDPR Masked
Tech City: GDPR Masked
Tech State/Province:
Tech Postal Code: GDPR Masked
Tech Country: CY
Tech Phone: +GDPR Masked.GDPR Masked
Tech Phone Ext:
Tech Fax: +GDPR Masked.GDPR Masked
Tech Fax Ext:
Tech Email: gdpr-masking@gdpr-masked.com
Name Server: cpns1.turhost.com
Name Server: cpns2.turhost.com
DNSSEC: Unsigned
Registrar Abuse Contact Email: abuse-contact@publicdomainregistry.com
Registrar Abuse Contact Phone: +1.2013775952
URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/
>>> Last update of WHOIS database: 2019-12-15T18:50:42Z <<<
For more information on Whois status codes, please visit https://icann.org/epp
Registration Service Provided By: GNET INTERNET TELEKOMUNIKASYON A.S.
The data in this whois database is provided to you for information purposes
only, that is, to assist you in obtaining information about or related to a
domain name registration record. We make this information available "as is",
and do not guarantee its accuracy. By submitting a whois query, you agree
that you will use this data only for lawful purposes and that, under no
circumstances will you use this data to:
(1) enable high volume, automated, electronic processes that stress or load
this whois database system providing you this information; or
(2) allow, enable, or otherwise support the transmission of mass unsolicited,
commercial advertising or solicitations via direct mail, electronic mail, or
by telephone.
The compilation, repackaging, dissemination or other use of this data is
expressly prohibited without prior written consent from us. The Registrar of
record is PDR Ltd. d/b/a PublicDomainRegistry.com.
We reserve the right to modify these terms at any time.
By submitting this query, you agree to abide by these terms.